(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02950

AM920435.PC20G02950  Location/Qualifiers
FT   CDS             join(675232..675527,675586..675742,675796..676243,
FT                   676302..679507)
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /note="unknown EC_number=2.7.7.48"
FT                   /note="Title: strong similarity to RNA-directed RNA
FT                   polymerase like protein An11g09540 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85624"
FT                   /db_xref="GOA:B6HF55"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF55"
FT                   /inference="protein motif:PFAM:PF05183"
FT                   /protein_id="CAP85624.1"
FT                   /translation="MTGPDLPSLQHPKSNLLRMVPPNIPTPARRNPPVLDLPVRDWITW
FT                   RSWRTCAVDLLNLPREMNTHDIYDAFHRYGNMISIDLWEDASGRPDCKGRIRFKPPPTE
FT                   EFWRTGSFGVKLRSGRVAVISLSVCCGDSNGTIQSPVRPDIQLPGEVELKTVQVDIGVL
FT                   LGLSTFHSMQSFTNLAYPRCVVDVMRKCLFLYFRVGIRGSDTADVNQHDHRVKITFLQL
FT                   TQIYQQYDKATRERSLLIVLDSAAIWHRKAKDIQSTLTEPLSWREEDSWYRQTSVTHNP
FT                   NSLKTLPANLKKTGHIIDLGRWNVFKISFAPDVDPNVRRVDDTSHYLMRVEEIFKDYNI
FT                   TVQDGSHFVEKADRPVPVWHWIDFSESKSNKASALLQDLGNQNYLHLPFKVRYQLEVCL
FT                   SQGYLSEFTMTREFIETLKGLGDDQATRLLEFVATEKKQYLAPMEIFDLKFFKGVTDSR
FT                   IPNYCCFMRTARITPTTIYYNTPTVDISNRVVREWSTKGTPGRFLRVRFTDEKTEGRIN
FT                   ASQRGCNDEVYTRVKRTLANGIAIGDRHYEFLAFGNSQFREHGAYFVAPDAGISAGTIR
FT                   AWMGQFNHIRNVAKYTARLGQCFSTTRAFTGSSVQTIPCDDIIRNGFTFSDGVGKISKF
FT                   LAQMVTSQHDIKTLTGEPPSAFQFRLGGAKGMLVVSTDPLPQEVHIRPSQQKFETSQAG
FT                   LEIIRWSQYSLATLNRQIILVLSALGIPDEVFHSKLNTMLGSFHRAMLNDSKAINLLQK
FT                   YIDPNQMTLTLAQMVSDGFRRNEEPFVNTMLELWKSWHLKHLKEKAKIAIDQGANVLGV
FT                   MDETGVLKGYFRKELPSRRASYAEKLAALPEIFVQVCRLDGGGEYEVIEGLCILARNPS
FT                   LHPGDIRVVRAVNRSELHALRDVVVLPQTGDQDIASMCSGGDLDGDDYLVIWDPNLIPA
FT                   NWFVECMDYKGSKAPDLDHDVTVDEITSFFVTYMKNDCLPRIAHAHLAWADRLPRGVWE
FT                   DKCIRLAQLHSDAVDYNKSGAHARMARSLDPKFWPHFMEKRFKRPSSIYKSTKILGQLY
FT                   DAVITPDFVPKLEKPFDSRILESPLAPASEAYMEYARELKAEFDMNMRQIMAQYEINTE
FT                   FEVWSTFVLRHGFVIKDYKMQEDLGRIVGTLRRGFRHQCYDKVGRDGGNIPALVIAMYR
FT                   VTQEQVAAALEARRNEALQREDVSIAEVNSTELPLISFPWIFPDVLGDVATGRARQAMI
FT                   SDGQESADSAKPIGEGLVFTHKQILKIVEDMDGDIKSTAENMKLKDPKNMEPKAEAGSN
FT                   SAPPDQELIARRRIDKTKPKQKSEDRDTGLYIEEDDEKEGGVAIGSAKTEEKIDKREAV
FT                   TEDIVEMEGDVKPSALDDLIKMIGG"
     MTGPDLPSLQ HPKSNLLRMV PPNIPTPARR NPPVLDLPVR DWITWRSWRT CAVDLLNLPR        60
     EMNTHDIYDA FHRYGNMISI DLWEDASGRP DCKGRIRFKP PPTEEFWRTG SFGVKLRSGR       120
     VAVISLSVCC GDSNGTIQSP VRPDIQLPGE VELKTVQVDI GVLLGLSTFH SMQSFTNLAY       180
     PRCVVDVMRK CLFLYFRVGI RGSDTADVNQ HDHRVKITFL QLTQIYQQYD KATRERSLLI       240
     VLDSAAIWHR KAKDIQSTLT EPLSWREEDS WYRQTSVTHN PNSLKTLPAN LKKTGHIIDL       300
     GRWNVFKISF APDVDPNVRR VDDTSHYLMR VEEIFKDYNI TVQDGSHFVE KADRPVPVWH       360
     WIDFSESKSN KASALLQDLG NQNYLHLPFK VRYQLEVCLS QGYLSEFTMT REFIETLKGL       420
     GDDQATRLLE FVATEKKQYL APMEIFDLKF FKGVTDSRIP NYCCFMRTAR ITPTTIYYNT       480
     PTVDISNRVV REWSTKGTPG RFLRVRFTDE KTEGRINASQ RGCNDEVYTR VKRTLANGIA       540
     IGDRHYEFLA FGNSQFREHG AYFVAPDAGI SAGTIRAWMG QFNHIRNVAK YTARLGQCFS       600
     TTRAFTGSSV QTIPCDDIIR NGFTFSDGVG KISKFLAQMV TSQHDIKTLT GEPPSAFQFR       660
     LGGAKGMLVV STDPLPQEVH IRPSQQKFET SQAGLEIIRW SQYSLATLNR QIILVLSALG       720
     IPDEVFHSKL NTMLGSFHRA MLNDSKAINL LQKYIDPNQM TLTLAQMVSD GFRRNEEPFV       780
     NTMLELWKSW HLKHLKEKAK IAIDQGANVL GVMDETGVLK GYFRKELPSR RASYAEKLAA       840
     LPEIFVQVCR LDGGGEYEVI EGLCILARNP SLHPGDIRVV RAVNRSELHA LRDVVVLPQT       900
     GDQDIASMCS GGDLDGDDYL VIWDPNLIPA NWFVECMDYK GSKAPDLDHD VTVDEITSFF       960
     VTYMKNDCLP RIAHAHLAWA DRLPRGVWED KCIRLAQLHS DAVDYNKSGA HARMARSLDP      1020
     KFWPHFMEKR FKRPSSIYKS TKILGQLYDA VITPDFVPKL EKPFDSRILE SPLAPASEAY      1080
     MEYARELKAE FDMNMRQIMA QYEINTEFEV WSTFVLRHGF VIKDYKMQED LGRIVGTLRR      1140
     GFRHQCYDKV GRDGGNIPAL VIAMYRVTQE QVAAALEARR NEALQREDVS IAEVNSTELP      1200
     LISFPWIFPD VLGDVATGRA RQAMISDGQE SADSAKPIGE GLVFTHKQIL KIVEDMDGDI      1260
     KSTAENMKLK DPKNMEPKAE AGSNSAPPDQ ELIARRRIDK TKPKQKSEDR DTGLYIEEDD      1320
     EKEGGVAIGS AKTEEKIDKR EAVTEDIVEM EGDVKPSALD DLIKMIGG                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page