(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03020

AM920435.PC20G03020  Location/Qualifiers
FT   CDS             join(696233..696761,696870..697078)
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SC5F2A.29 - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85631"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5"
FT                   /inference="similar to AA sequence:PIR:T35271"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /inference="protein motif:COGS:COG4977"
FT                   /inference="protein motif:COGS:COG0693"
FT                   /protein_id="CAP85631.1"
FT                   /translation="MSSPLRIGVLLVGTVQLLDLSAVDLLYMTTPEYLQECSLPRPLVD
FT                   LGRPCEIHYIAHNANDTAKTTAQMSLQLTDSLTDSAVSPGKLDIVLIPGPPPKAMPPPE
FT                   EYLDFVRAHFAAGAPILSVCTGAYVIGHAGITKGREVTAPRLLIPEMRRKFPEAKLWDD
FT                   SVRVARDGNLWTSGGITNGHDLVAGYLREHYPAALVNTILVAADIPSRPAAYATPAVSD
FT                   TLYILWQIIRAVPNAVVGWFRGR"
     MSSPLRIGVL LVGTVQLLDL SAVDLLYMTT PEYLQECSLP RPLVDLGRPC EIHYIAHNAN        60
     DTAKTTAQMS LQLTDSLTDS AVSPGKLDIV LIPGPPPKAM PPPEEYLDFV RAHFAAGAPI       120
     LSVCTGAYVI GHAGITKGRE VTAPRLLIPE MRRKFPEAKL WDDSVRVARD GNLWTSGGIT       180
     NGHDLVAGYL REHYPAALVN TILVAADIPS RPAAYATPAV SDTLYILWQI IRAVPNAVVG       240
     WFRGR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page