(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03060

AM920435.PC20G03060  Location/Qualifiers
FT   CDS             join(705768..705817,705874..705920,705990..706091,
FT                   706238..706359,706412..706613,706669..706787)
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /note="unknown EC_number=3.1.5.1"
FT                   /note="Title: strong similarity to GTPase Rho3
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85635"
FT                   /db_xref="GOA:B6HFE8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE8"
FT                   /inference="similar to AA sequence:PIR:S49891"
FT                   /inference="protein motif:PFAM:PF00071"
FT                   /inference="protein motif:COGS:COG1217"
FT                   /inference="protein motif:COGS:COG0481"
FT                   /protein_id="CAP85635.1"
FT                   /translation="MQLCGRQKVVQRKMVLLGDGACGKTSALNVFTPSSPRFSKKFYYL
FT                   QKHTSKCRLLTLVIGCTQRAYNIFVDNIHVELSLWDTAGQEEFDRLRALSYEDTHVLML
FT                   CFSVDSPDSFENVSSKWIAEINENCPGVRVVLTALKCDLRKDEDMNENPNTISFDQGLA
FT                   KAKEIGAVKYLECSAVQNRGIRESFYEAAKVALEVNAGGSSSSGSQCIIQ"
     MQLCGRQKVV QRKMVLLGDG ACGKTSALNV FTPSSPRFSK KFYYLQKHTS KCRLLTLVIG        60
     CTQRAYNIFV DNIHVELSLW DTAGQEEFDR LRALSYEDTH VLMLCFSVDS PDSFENVSSK       120
     WIAEINENCP GVRVVLTALK CDLRKDEDMN ENPNTISFDQ GLAKAKEIGA VKYLECSAVQ       180
     NRGIRESFYE AAKVALEVNA GGSSSSGSQC IIQ                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page