(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03070

AM920435.PC20G03070  Location/Qualifiers
FT   CDS             complement(707706..708614)
FT                   /gene="Pc20g03070"
FT                   /locus_tag="PCH_Pc20g03070"
FT                   /note="Title: similarity to lipoyl-protein ligase LIPB
FT                   -Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85636"
FT                   /db_xref="GOA:B6HFE9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE9"
FT                   /inference="similar to AA sequence:SWISSPROT:LIPB_KLULA"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /inference="protein motif:COGS:COG0321"
FT                   /protein_id="CAP85636.1"
FT                   /translation="MRLAHLHLPHTTPFSRVSHLQQTLTTRLLTHKKLASPGSISSQEP
FT                   SNPSATLSKTPPSPPDPTIITFTPNPVYTTGRRDLPPSNTSPPSTTNPILSLPPALEPI
FT                   RSLFTPDGTKPAKAEYHPTLRGGQTTYHGPGQMVAYTILDLKRLGLTPRCHIRVLENSV
FT                   IDLLKSYGVEGFTTEDPGVWVNPVSGSRSASGSALQPRKITAVGVHLRRNISSFGIGLN
FT                   VTDEPMWFFKQIVACGLEGKEATSLQGVGVPGLEVGDVAAAFVEKFVSRVNADFACGEN
FT                   SLGEKIDEVYQVREEDLLNSV"
     MRLAHLHLPH TTPFSRVSHL QQTLTTRLLT HKKLASPGSI SSQEPSNPSA TLSKTPPSPP        60
     DPTIITFTPN PVYTTGRRDL PPSNTSPPST TNPILSLPPA LEPIRSLFTP DGTKPAKAEY       120
     HPTLRGGQTT YHGPGQMVAY TILDLKRLGL TPRCHIRVLE NSVIDLLKSY GVEGFTTEDP       180
     GVWVNPVSGS RSASGSALQP RKITAVGVHL RRNISSFGIG LNVTDEPMWF FKQIVACGLE       240
     GKEATSLQGV GVPGLEVGDV AAAFVEKFVS RVNADFACGE NSLGEKIDEV YQVREEDLLN       300
     SV                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page