(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03080

AM920435.PC20G03080  Location/Qualifiers
FT   CDS             complement(join(709087..709698,709763..709879))
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT                   /note="Title: strong similarity to hypothetical GTPase
FT                   activating protein homolog GAP1 - Cochliobolus
FT                   heterostrophus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85637"
FT                   /db_xref="GOA:B6HFF0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF0"
FT                   /inference="similar to AA sequence:TREMBL:AF027687.2"
FT                   /protein_id="CAP85637.1"
FT                   /translation="MAESLNPPLSYEASATTTHPHVATSLPSEVIACLKNSRFLHLATC
FT                   DDKTPHISLMSYTYLPSTPFDPHPIIIMTTNPASRKTNHLLSNPRVSLLVHDWVSHRPP
FT                   TRAPTQGDREGSPPPAATRSSLASLLLNLNTSALSSISTTITGEAQFLEPGSEEESWCK
FT                   ARHLENNTFEEEEINLFGQQQQQDPSARRPSLSIDTDVRVVTVRVTEGRIADWKGGVRD
FT                   WVLLPAEQQDAGLVNGVASS"
     MAESLNPPLS YEASATTTHP HVATSLPSEV IACLKNSRFL HLATCDDKTP HISLMSYTYL        60
     PSTPFDPHPI IIMTTNPASR KTNHLLSNPR VSLLVHDWVS HRPPTRAPTQ GDREGSPPPA       120
     ATRSSLASLL LNLNTSALSS ISTTITGEAQ FLEPGSEEES WCKARHLENN TFEEEEINLF       180
     GQQQQQDPSA RRPSLSIDTD VRVVTVRVTE GRIADWKGGV RDWVLLPAEQ QDAGLVNGVA       240
     SS                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page