(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03110

AM920435.PC20G03110  Location/Qualifiers
FT   CDS             join(713065..713204,713409..713418,713495..713652,
FT                   713712..713758,713831..713926,713982..714649,
FT                   714711..714824)
FT                   /gene="Pc20g03110"
FT                   /locus_tag="PCH_Pc20g03110"
FT                   /note="unknown EC_number=2.7.8.-"
FT                   /note="Title: strong similarity to
FT                   aminoalcoholphosphotransferase AAPT1 - Glycine max"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85640"
FT                   /db_xref="GOA:B6HFF3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF3"
FT                   /inference="similar to AA sequence:PIR:T06384"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /inference="protein motif:COGS:COG5050"
FT                   /inference="protein motif:COGS:COG0558"
FT                   /protein_id="CAP85640.1"
FT                   /translation="MVYIRQHELANLKNYKYAGVDHSPVSRFILKPFYNKCVIPCFPMG
FT                   MAPNAITLSGFMFVVINFLTVMWYNPNLDTDCPPWVYASCAIGLFLYQTFDAVDGMQAR
FT                   RTRQSGPLGELFDHSVDACNTGLSVLVFAAAMNMGQSWMTFIALFGSTMTFYVQTWDEY
FT                   YTQILTLGVISGPVEGILTLCVVYIFTAYMGGGSFWHQPMLETIGVPKPSFLSSQVYNM
FT                   PFTQWYLVYGAIMLCFAISSSVMHVMKVRRERGQDPFSPLYGLLPLAVIWTLIPAYLYL
FT                   QPVILENHTIPFGLFVSLVNAYSVGRIIIGHLTQTSFPYQNVLLYPLALGVLDSVGALI
FT                   GLWSAPMLGYGVGQVGFVFGLLGLAVGVYGSFVFDIITTICDYIDIWCLTIKYPFVEET
FT                   ERKTGVSKKTI"
     MVYIRQHELA NLKNYKYAGV DHSPVSRFIL KPFYNKCVIP CFPMGMAPNA ITLSGFMFVV        60
     INFLTVMWYN PNLDTDCPPW VYASCAIGLF LYQTFDAVDG MQARRTRQSG PLGELFDHSV       120
     DACNTGLSVL VFAAAMNMGQ SWMTFIALFG STMTFYVQTW DEYYTQILTL GVISGPVEGI       180
     LTLCVVYIFT AYMGGGSFWH QPMLETIGVP KPSFLSSQVY NMPFTQWYLV YGAIMLCFAI       240
     SSSVMHVMKV RRERGQDPFS PLYGLLPLAV IWTLIPAYLY LQPVILENHT IPFGLFVSLV       300
     NAYSVGRIII GHLTQTSFPY QNVLLYPLAL GVLDSVGALI GLWSAPMLGY GVGQVGFVFG       360
     LLGLAVGVYG SFVFDIITTI CDYIDIWCLT IKYPFVEETE RKTGVSKKTI                  410
//

If you have problems or comments...

PBIL Back to PBIL home page