(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03130

AM920435.PC20G03130  Location/Qualifiers
FT   CDS             complement(join(717788..718088,718205..718242))
FT                   /gene="Pc20g03130"
FT                   /locus_tag="PCH_Pc20g03130"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_960wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85642"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF5"
FT                   /protein_id="CAP85642.1"
FT                   /translation="MSTTNIQDLNAKISAFESHPQCKPPNTHPTIFFLYDFVRNTHNQL
FT                   KAVDAEKYAAGDNGAKNAVGEVEGRNAFANMLINDTSGKLSMMTGGNPSNPADFGAEIK
FT                   AKAQILTQ"
     MSTTNIQDLN AKISAFESHP QCKPPNTHPT IFFLYDFVRN THNQLKAVDA EKYAAGDNGA        60
     KNAVGEVEGR NAFANMLIND TSGKLSMMTG GNPSNPADFG AEIKAKAQIL TQ               112
//

If you have problems or comments...

PBIL Back to PBIL home page