(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03200

AM920435.PC20G03200  Location/Qualifiers
FT   CDS             733195..734445
FT                   /gene="Pc20g03200"
FT                   /locus_tag="PCH_Pc20g03200"
FT                   /note="unknown EC_number=2.8.1.-"
FT                   /note="Title: strong similarity to lipoic acid synthase
FT                   Lip5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85649"
FT                   /db_xref="GOA:B6HFQ1"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFQ1"
FT                   /inference="similar to AA sequence:PIR:S42159"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /inference="protein motif:COGS:COG0320"
FT                   /protein_id="CAP85649.1"
FT                   /translation="MAAPTRSLRRLSSFRTTISPSLTVTAPIGCRSYATTDSSSATNTP
FT                   GTTRRRATKFQDKLNAGPSFSDFVSGGQDEPLDPSEAYALKTALVGPAGRKKEMTRLPE
FT                   WLKTPIPDSKNYQRLKKDLRGLNLHTVCEEARCPNISDCWGGSDKSSATATIMLMGDTC
FT                   TRGCRFCSVKTSRAPPPLDPHEPENTAEAISRWSLGYVVLTSVDRDDLVDGGARHFAET
FT                   VIKIKQKKPSMLVECLTGDFRGDTEMAALVARSGLDVYAHNVETVEELTPFVRDRRATF
FT                   QQSIRVLDSAKKAVPELVTKTSLMLGLGETDEQLWDALRQLRAVNVDVVTFGQYMRPTK
FT                   RHMAVHEYVTPDRFELWRQRALDMGFLYCASGPLVRSSYKAGEAFIENVLKKRRAGSGT
FT                   AERTVDQTAATTDEATR"
     MAAPTRSLRR LSSFRTTISP SLTVTAPIGC RSYATTDSSS ATNTPGTTRR RATKFQDKLN        60
     AGPSFSDFVS GGQDEPLDPS EAYALKTALV GPAGRKKEMT RLPEWLKTPI PDSKNYQRLK       120
     KDLRGLNLHT VCEEARCPNI SDCWGGSDKS SATATIMLMG DTCTRGCRFC SVKTSRAPPP       180
     LDPHEPENTA EAISRWSLGY VVLTSVDRDD LVDGGARHFA ETVIKIKQKK PSMLVECLTG       240
     DFRGDTEMAA LVARSGLDVY AHNVETVEEL TPFVRDRRAT FQQSIRVLDS AKKAVPELVT       300
     KTSLMLGLGE TDEQLWDALR QLRAVNVDVV TFGQYMRPTK RHMAVHEYVT PDRFELWRQR       360
     ALDMGFLYCA SGPLVRSSYK AGEAFIENVL KKRRAGSGTA ERTVDQTAAT TDEATR           416
//

If you have problems or comments...

PBIL Back to PBIL home page