(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03210

AM920435.PC20G03210  Location/Qualifiers
FT   CDS             complement(join(735132..735455,735516..735773,
FT                   735831..736652))
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /note="unknown EC_number=3.1.3.3"
FT                   /note="Title: strong similarity to phosphoserine
FT                   phosphatase Ser2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85650"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ2"
FT                   /inference="similar to AA sequence:PIR:S53931"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /inference="protein motif:COGS:COG0560"
FT                   /protein_id="CAP85650.1"
FT                   /translation="MAESTRTTRPSLGQMRSSSFLQDHQQYKPMAPINPISQTIGEVLA
FT                   NQTEDQLVLNSNPIKPDPERVTDSGIIHSIFNHQANPLPTGTSQVVATIYYKSNNPVHP
FT                   HYHPDSGPQNVPGDKIPAPKVPEGSAPTEDMDKFPREPPAPEPEPLDHLYGPYVSQLCL
FT                   TNFLQILETLPTPYQRMNTSHRCLDRDEHPRVVEVTFSPPPNPEYLSFPDLRKHESIWR
FT                   FEREWNVEVVLQKESVFRRHKRLAVFDMDSTLIDNECIDEIAKFIGVEKEVSEITERAM
FT                   NGELDFTASLKERVGLLNGVSADVFEKLKSVLKIAKGARELCRALKALGYKIAVVSGGF
FT                   QPLAEWLAGQLGIDIAIANHLEIDEATQTLTGKLVPSYPIVDAAHKRTLLKSIAAENGI
FT                   PLSQTMAVGDGANDLLMLHAAGLGVAWRAKSKVQLEAPVRINGESLVDVLYLLGMDNED
FT                   IAELTSDVQ"
     MAESTRTTRP SLGQMRSSSF LQDHQQYKPM APINPISQTI GEVLANQTED QLVLNSNPIK        60
     PDPERVTDSG IIHSIFNHQA NPLPTGTSQV VATIYYKSNN PVHPHYHPDS GPQNVPGDKI       120
     PAPKVPEGSA PTEDMDKFPR EPPAPEPEPL DHLYGPYVSQ LCLTNFLQIL ETLPTPYQRM       180
     NTSHRCLDRD EHPRVVEVTF SPPPNPEYLS FPDLRKHESI WRFEREWNVE VVLQKESVFR       240
     RHKRLAVFDM DSTLIDNECI DEIAKFIGVE KEVSEITERA MNGELDFTAS LKERVGLLNG       300
     VSADVFEKLK SVLKIAKGAR ELCRALKALG YKIAVVSGGF QPLAEWLAGQ LGIDIAIANH       360
     LEIDEATQTL TGKLVPSYPI VDAAHKRTLL KSIAAENGIP LSQTMAVGDG ANDLLMLHAA       420
     GLGVAWRAKS KVQLEAPVRI NGESLVDVLY LLGMDNEDIA ELTSDVQ                     467
//

If you have problems or comments...

PBIL Back to PBIL home page