(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03290

AM920435.PC20G03290  Location/Qualifiers
FT   CDS             complement(join(754698..755089,755199..755436,
FT                   755551..755628))
FT                   /gene="Pc20g03290"
FT                   /locus_tag="PCH_Pc20g03290"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1495_2.tfa_640cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85658"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /inference="protein motif:COGS:COG0693"
FT                   /protein_id="CAP85658.1"
FT                   /translation="MTPKVLVVLTSHDKLGSTGNPTGWYLPEFAHPWEVLHEKVSLTIA
FT                   SPKGGEAPLDPASVKMFESDEASQKFLKEQKALWTNTHKLADVLPRAGEFDAIFYVGGH
FT                   GPMFDLTEDPTSLALIQTFAAANKPVAAVCHGPCVLLNATAPSGVPLISGVGVTGFSNA
FT                   EEDAVSLSAAMPFMLETELGRVSGGKYVKAAEPWGEMVVVGKAAGTGSTIITGQNPGSA
FT                   TGVGKEILKALGL"
     MTPKVLVVLT SHDKLGSTGN PTGWYLPEFA HPWEVLHEKV SLTIASPKGG EAPLDPASVK        60
     MFESDEASQK FLKEQKALWT NTHKLADVLP RAGEFDAIFY VGGHGPMFDL TEDPTSLALI       120
     QTFAAANKPV AAVCHGPCVL LNATAPSGVP LISGVGVTGF SNAEEDAVSL SAAMPFMLET       180
     ELGRVSGGKY VKAAEPWGEM VVVGKAAGTG STIITGQNPG SATGVGKEIL KALGL            235
//

If you have problems or comments...

PBIL Back to PBIL home page