(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03320

AM920435.PC20G03320  Location/Qualifiers
FT   CDS             join(761455..761601,761656..761952)
FT                   /gene="Pc20g03320"
FT                   /locus_tag="PCH_Pc20g03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85661"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20"
FT                   /protein_id="CAP85661.1"
FT                   /translation="MEGVPAHLAACGILIIHVLACTQLSSHEPKPESERAGGLASNRSK
FT                   LKTPGLGYVRDWERGRQVSNPFGELSRVLFSEPSGELAGAETVHGTLGVRCLLAVRILG
FT                   GGCVGCDGGADGCLYSCREASKGILRGKTLSQSKKKERKSALA"
     MEGVPAHLAA CGILIIHVLA CTQLSSHEPK PESERAGGLA SNRSKLKTPG LGYVRDWERG        60
     RQVSNPFGEL SRVLFSEPSG ELAGAETVHG TLGVRCLLAV RILGGGCVGC DGGADGCLYS       120
     CREASKGILR GKTLSQSKKK ERKSALA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page