(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03340

AM920435.PC20G03340  Location/Qualifiers
FT   CDS             join(766904..766928,767062..767071,767214..767267,
FT                   767332..767474,767572..767669)
FT                   /gene="Pc20g03340"
FT                   /locus_tag="PCH_Pc20g03340"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit Rpl37b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85663"
FT                   /db_xref="GOA:B6HG22"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG22"
FT                   /inference="similar to AA sequence:SWISSPROT:R372_YEAST"
FT                   /inference="protein motif:PFAM:PF01247"
FT                   /inference="protein motif:COGS:COG2451"
FT                   /protein_id="CAP85663.1"
FT                   /translation="MPSEQGHRLYVKGRHLSFQRSKHALTQNTSLVKIEGVDDTKAAKF
FT                   YLGKKVAFVYRAKREVRGSNIRVIWGKVTRPHGNSGVVRAKFRNNLPPKSLGATVRVML
FT                   YPSNI"
     MPSEQGHRLY VKGRHLSFQR SKHALTQNTS LVKIEGVDDT KAAKFYLGKK VAFVYRAKRE        60
     VRGSNIRVIW GKVTRPHGNS GVVRAKFRNN LPPKSLGATV RVMLYPSNI                   109
//

If you have problems or comments...

PBIL Back to PBIL home page