(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03350

AM920435.PC20G03350  Location/Qualifiers
FT   CDS             complement(join(768446..768466,768554..768577,
FT                   768621..769349))
FT                   /gene="Pc20g03350"
FT                   /locus_tag="PCH_Pc20g03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85664"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG23"
FT                   /protein_id="CAP85664.1"
FT                   /translation="MAWSTRNSIIPESSFPWSDGELENWRTEYLKQPETLFMSPSPDPS
FT                   TTTRTPTARPPSYNYQQQLPSNQLPSAQFPSTPVALGTMLSPTPSSSYLDPSTIKRSIS
FT                   NHSPRSVPTQATATVLSPASLYDVRCPSPWDDLPVSTPIIKETLQSESDEVRTEPSQTK
FT                   MPCLTRRRTTKRKCVFCSLLKAIMSIRMLNICRLEKPRITELSNANGRTVNMTVCSRAK
FT                   VCSSGTFRHSISILGLSSVPGTIDSQGNVWSSDWI"
     MAWSTRNSII PESSFPWSDG ELENWRTEYL KQPETLFMSP SPDPSTTTRT PTARPPSYNY        60
     QQQLPSNQLP SAQFPSTPVA LGTMLSPTPS SSYLDPSTIK RSISNHSPRS VPTQATATVL       120
     SPASLYDVRC PSPWDDLPVS TPIIKETLQS ESDEVRTEPS QTKMPCLTRR RTTKRKCVFC       180
     SLLKAIMSIR MLNICRLEKP RITELSNANG RTVNMTVCSR AKVCSSGTFR HSISILGLSS       240
     VPGTIDSQGN VWSSDWI                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page