(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03390

AM920435.PC20G03390  Location/Qualifiers
FT   CDS             complement(join(777936..778137,778205..778671))
FT                   /gene="Pc20g03390"
FT                   /locus_tag="PCH_Pc20g03390"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An12g03400 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85668"
FT                   /db_xref="GOA:B6HG26"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG26"
FT                   /inference="protein motif:COGS:COG5048"
FT                   /protein_id="CAP85668.1"
FT                   /translation="MAGPPHHVPLSASGTPGQDESTRDLYLPYGYAAHQYPPSLAAEPS
FT                   TFSENHLLYNTLMQHSSAPVHLSYSMPFSSAHGTFNPASHNMAHHPSSENNTPSDPSTM
FT                   GYISSGYSTACTTPLGSGRSSPSMQEIPQSSVSRPEVPTICGRGRAHRPKHDELYGMYQ
FT                   CNWKDCKYRGMFSRKGVLMRHIETQHVAPHSFDCPVCGKLFCRRDNMTEHLGKVQCQRV
FT                   "
     MAGPPHHVPL SASGTPGQDE STRDLYLPYG YAAHQYPPSL AAEPSTFSEN HLLYNTLMQH        60
     SSAPVHLSYS MPFSSAHGTF NPASHNMAHH PSSENNTPSD PSTMGYISSG YSTACTTPLG       120
     SGRSSPSMQE IPQSSVSRPE VPTICGRGRA HRPKHDELYG MYQCNWKDCK YRGMFSRKGV       180
     LMRHIETQHV APHSFDCPVC GKLFCRRDNM TEHLGKVQCQ RV                          222
//

If you have problems or comments...

PBIL Back to PBIL home page