(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03440

AM920435.PC20G03440  Location/Qualifiers
FT   CDS             join(788016..788104,788308..788547,788606..788729,
FT                   788784..788885)
FT                   /gene="Pc20g03440"
FT                   /locus_tag="PCH_Pc20g03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85673"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31"
FT                   /protein_id="CAP85673.1"
FT                   /translation="MARAQYLGSYQPPLTSTLPTILSTQVAISPAWSSSSSREVRAAPL
FT                   VGFSSVVQLPLLRGLDSLAAGEVGGLLTAELLDCGSGGLQAKRGVAGELPQGLAYHHGT
FT                   ESTYHGGAHVRGAGEIGVETLCFALADKIYQYLPANEGLIGAKVDGNANVPQRANLHSS
FT                   REYAPFENKTFNGGAGSDANC"
     MARAQYLGSY QPPLTSTLPT ILSTQVAISP AWSSSSSREV RAAPLVGFSS VVQLPLLRGL        60
     DSLAAGEVGG LLTAELLDCG SGGLQAKRGV AGELPQGLAY HHGTESTYHG GAHVRGAGEI       120
     GVETLCFALA DKIYQYLPAN EGLIGAKVDG NANVPQRANL HSSREYAPFE NKTFNGGAGS       180
     DANC                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page