(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03500

AM920435.PC20G03500  Location/Qualifiers
FT   CDS             join(802415..802509,802588..802619,802726..802775,
FT                   802866..802870,802948..803032,803086..803613)
FT                   /gene="Pc20g03500"
FT                   /locus_tag="PCH_Pc20g03500"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC31F10.03 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85679"
FT                   /db_xref="GOA:B6HGE8"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE8"
FT                   /inference="similar to AA sequence:PIR:T40206"
FT                   /inference="protein motif:PFAM:PF04752"
FT                   /inference="protein motif:COGS:COG3703"
FT                   /protein_id="CAP85679.1"
FT                   /translation="MAAIAQGHKVHPDGRTWKSHFPKGDLWVFGYGSLIWKPPPHYDQR
FT                   IPGYISGYVRRFWQASTDHRGTPEQPGRVVTVIERTFWETLDDPIAHLESELSSTGKVW
FT                   GAAYHIPASHAEEVHDYLDEREIDGYSAHYTPFHPTVDVEGAGDSTGSSPIICMVYIGQ
FT                   PTNPQFLRDAAHREPQHVAQVISAGHGLSGKGSEYLFMLEKGLEGLGLGTADVHVTDLV
FT                   KRVKAIEAELAEAEEEEAEIKVTRSLEIPAEEVDRDGRETIE"
     MAAIAQGHKV HPDGRTWKSH FPKGDLWVFG YGSLIWKPPP HYDQRIPGYI SGYVRRFWQA        60
     STDHRGTPEQ PGRVVTVIER TFWETLDDPI AHLESELSST GKVWGAAYHI PASHAEEVHD       120
     YLDEREIDGY SAHYTPFHPT VDVEGAGDST GSSPIICMVY IGQPTNPQFL RDAAHREPQH       180
     VAQVISAGHG LSGKGSEYLF MLEKGLEGLG LGTADVHVTD LVKRVKAIEA ELAEAEEEEA       240
     EIKVTRSLEI PAEEVDRDGR ETIE                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page