(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03510

AM920435.PC20G03510  Location/Qualifiers
FT   CDS             complement(join(804799..805063,805122..805228,
FT                   805295..805378))
FT                   /gene="Pc20g03510"
FT                   /locus_tag="PCH_Pc20g03510"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_51_scaffold_3.tfa_1450cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85680"
FT                   /db_xref="GOA:B6HGE9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE9"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /inference="protein motif:COGS:COG0724"
FT                   /protein_id="CAP85680.1"
FT                   /translation="MDFSGLSWHTSDDTLREGFQQFGEIQEAIVVKDRATQRSRGFGFV
FT                   RFATDAEADAALGAMNNQEFDGRVIRVDKAFDRPQRSEGGFQGRGGYNSQPQSSYQGGA
FT                   GGYAGYNNGGYNNGAAGGYGGGYNRGYNNYAPSGPAGYGAGGPGGYG"
     MDFSGLSWHT SDDTLREGFQ QFGEIQEAIV VKDRATQRSR GFGFVRFATD AEADAALGAM        60
     NNQEFDGRVI RVDKAFDRPQ RSEGGFQGRG GYNSQPQSSY QGGAGGYAGY NNGGYNNGAA       120
     GGYGGGYNRG YNNYAPSGPA GYGAGGPGGY G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page