(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03540

AM920435.PC20G03540  Location/Qualifiers
FT   CDS             join(810839..811464,811529..811826)
FT                   /gene="Pc20g03540"
FT                   /locus_tag="PCH_Pc20g03540"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor eIF-2 beta chain Sui3 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85683"
FT                   /db_xref="GOA:B6HGF2"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF2"
FT                   /inference="similar to AA sequence:PIR:S29368"
FT                   /inference="protein motif:PFAM:PF01873"
FT                   /inference="protein motif:COGS:COG1601"
FT                   /inference="protein motif:COGS:COG1326"
FT                   /protein_id="CAP85683.1"
FT                   /translation="MDTNGQVTDAPPAEKPTGGMQYLSDPSLNPPVAFATAPLTMSEYT
FT                   EKEVDEVTEMFKGLSKKKKPSKKSKTADAGDDEEAPAADGEFDPSALKKKKKSSSKSKK
FT                   ADATDFDAKLAEAGIAEEAGEEKPEEIPEGDLEAGTGIWAHDATQTIPYSLLVSRFFSL
FT                   IESHHPDLLATGAKSYKIPPPQCLREGNRRTIFANIADICKRMKRSEEHCTQFLFAELG
FT                   TSGSVDGSRRLVIKGRFQQKGIESVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTCN
FT                   SCGSRRSVAAIKTGFRSQIGRRKRVG"
     MDTNGQVTDA PPAEKPTGGM QYLSDPSLNP PVAFATAPLT MSEYTEKEVD EVTEMFKGLS        60
     KKKKPSKKSK TADAGDDEEA PAADGEFDPS ALKKKKKSSS KSKKADATDF DAKLAEAGIA       120
     EEAGEEKPEE IPEGDLEAGT GIWAHDATQT IPYSLLVSRF FSLIESHHPD LLATGAKSYK       180
     IPPPQCLREG NRRTIFANIA DICKRMKRSE EHCTQFLFAE LGTSGSVDGS RRLVIKGRFQ       240
     QKGIESVLRR YIVEYVTCKT CRSPDTELNK GENRLYFVTC NSCGSRRSVA AIKTGFRSQI       300
     GRRKRVG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page