(data stored in SCRATCH zone)

EMBL: AM920435.RFX

AM920435.RFX         Location/Qualifiers
FT   CDS             join(383870..383885,383933..383961,384011..384669,
FT                   384724..385041,385094..386651)
FT                   /gene="RFX"
FT                   /locus_tag="PCH_Pc20g01690"
FT                   /product="transcription factor like protein RFX-Penicillium
FT                   chrysogenum"
FT                   /note="Gene-ID: RFX"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85498"
FT                   /db_xref="GOA:B6HDQ4"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039779"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ4"
FT                   /inference="similar to AA sequence:TREMBL:PCH243296.1"
FT                   /inference="protein motif:PFAM:PF02257"
FT                   /protein_id="CAP85498.1"
FT                   /translation="MPPELGYLVPGANVLIAPQSRPGTADPVRARSEALSRASRRPRSR
FT                   GSTASIHSSTTQQTQDQHLDGFPQFMPSQVGTGQHMFNNPEDMLMRFGHQLSHHNGAPL
FT                   DQSMQDTHAGMSRTEDFPNHPMQGHPLSHHPIQPEIASGLSGVSVPQYQPMYDSGVENH
FT                   LPDHIVEDQEVSEPGTKKKRGASSTVANDNELRKLLRQYEGWSLKQMAAEVMKNEGGGG
FT                   KAEKVKQVFAMIWLRENCRKSSGSVRRDRVYCCYAENCGTERVSVLNPASFGKLVRIIF
FT                   PNVQTRRLGVRGESKYHYVDLSVIEEKQQKLAPLNPQIAHHSTGPASMPSRAASAMRSR
FT                   SASVQQPTADTAVFPSPTTSFPPRFPNNASPADCNCQSHTPSGPEATITRENVAQQAGK
FT                   MIHQMLQFPTDENPLVDNDTLQLPDIRAYLPSNTDLKVAAALAALYRSHCISVIDSFRY
FT                   CKERNLMKYFSAFHGTLTVPVQKLLTHPNLAPWIKECDWMMYQKMIAFVAPLTTQVVPK
FT                   PVLDAFNSISQRLCGHIAETFKTQPTHVSIARLIPAHIFCNLLKHMLDVNQAANAAAAW
FT                   LCHPDNRNQMWTDFKTMVNPRDMMTKANIPTCAELATEQILKHDIRALLTPLSDADPSA
FT                   SLLFFTQPDTPDSVEAHKFPVESAPGDEYNFPDKWVQFILNIPAAFANHRTQCVIEKVD
FT                   ALWDSVLHRLTLAGAPSFSAWWMTKVFFHEMMVWQAEKGGFMRNTPGSLQSATFGPESL
FT                   GHFQMKQASVPETSPFEASNDSQAKSNPSPPVAHNGHQSHPPSQHPEFKHPPTEKRLSL
FT                   QDPGFQGHNNDDSAIDLEDDTMLLAVGKYGDMMVSDPADAEGDVVVI"
     MPPELGYLVP GANVLIAPQS RPGTADPVRA RSEALSRASR RPRSRGSTAS IHSSTTQQTQ        60
     DQHLDGFPQF MPSQVGTGQH MFNNPEDMLM RFGHQLSHHN GAPLDQSMQD THAGMSRTED       120
     FPNHPMQGHP LSHHPIQPEI ASGLSGVSVP QYQPMYDSGV ENHLPDHIVE DQEVSEPGTK       180
     KKRGASSTVA NDNELRKLLR QYEGWSLKQM AAEVMKNEGG GGKAEKVKQV FAMIWLRENC       240
     RKSSGSVRRD RVYCCYAENC GTERVSVLNP ASFGKLVRII FPNVQTRRLG VRGESKYHYV       300
     DLSVIEEKQQ KLAPLNPQIA HHSTGPASMP SRAASAMRSR SASVQQPTAD TAVFPSPTTS       360
     FPPRFPNNAS PADCNCQSHT PSGPEATITR ENVAQQAGKM IHQMLQFPTD ENPLVDNDTL       420
     QLPDIRAYLP SNTDLKVAAA LAALYRSHCI SVIDSFRYCK ERNLMKYFSA FHGTLTVPVQ       480
     KLLTHPNLAP WIKECDWMMY QKMIAFVAPL TTQVVPKPVL DAFNSISQRL CGHIAETFKT       540
     QPTHVSIARL IPAHIFCNLL KHMLDVNQAA NAAAAWLCHP DNRNQMWTDF KTMVNPRDMM       600
     TKANIPTCAE LATEQILKHD IRALLTPLSD ADPSASLLFF TQPDTPDSVE AHKFPVESAP       660
     GDEYNFPDKW VQFILNIPAA FANHRTQCVI EKVDALWDSV LHRLTLAGAP SFSAWWMTKV       720
     FFHEMMVWQA EKGGFMRNTP GSLQSATFGP ESLGHFQMKQ ASVPETSPFE ASNDSQAKSN       780
     PSPPVAHNGH QSHPPSQHPE FKHPPTEKRL SLQDPGFQGH NNDDSAIDLE DDTMLLAVGK       840
     YGDMMVSDPA DAEGDVVVI                                                    859
//

If you have problems or comments...

PBIL Back to PBIL home page