(data stored in ACNUC7421 zone)

EMBL: AM946981.ACRA

AM946981.ACRA        Location/Qualifiers
FT   CDS             complement(453466..454659)
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="B21_00419"
FT                   /product="AcrA membrane fusion protein, subunit of
FT                   AcrAB-TolC multidrug efflux transport system and AcrAD-TolC
FT                   multidrug efflux transport system"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00419"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30936"
FT                   /protein_id="CAQ30936.1"
FT                   /translation="MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTV
FT                   KTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVAS
FT                   QAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
     MNKNRGFTPL AVVLMLSGSL ALTGCDDKQA QQGGQQMPAV GVVTVKTEPL QITTELPGRT        60
     SAYRIAEVRP QVSGIILKRN FKEGSDIEAG VSLYQIDPAT YQATYDSAKG DLAKAQAAAN       120
     IAQLTVNRYQ KLLGTQYISK QEYDQALADA QQANAAVTAA KAAVETARIN LAYTKVTSPI       180
     SGRIGKSNVT EGALVQNGQA TALATVQQLD PIYVDVTQSS NDFLRLKQEL ANGTLKQENG       240
     KAKVSLITSD GIKFPQDGTL EFSDVTVDQT TGSITLRAIF PNPDHTLLPG MFVRARLEEG       300
     LNPNAILVPQ QGVTRTPRGD ATVLVVGADD KVETRPIVAS QAIGDKWLVT EGLKAGDRVV       360
     ISGLQKVRPG VQVKAQEVTA DNNQQAASGA QPEQSKS                                397
//

If you have problems or comments...

PBIL Back to PBIL home page