(data stored in SCRATCH zone)

EMBL: AM946981.ARTI

AM946981.ARTI        Location/Qualifiers
FT   CDS             complement(906955..907686)
FT                   /transl_table=11
FT                   /gene="artI"
FT                   /locus_tag="B21_00874"
FT                   /product="artI, subunit of arginine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00874"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31391"
FT                   /protein_id="CAQ31391.1"
FT                   /translation="MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVG
FT                   FDVDLAQALCKEIDATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPY
FT                   YDNSALFVGQQGKYTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDL
FT                   QNGRIDGVFGDTAVVTEWLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNT
FT                   ALEKVKKDGTYETIYNKWFQK"
     MKKVLIAALI AGFSLSATAA ETIRFATEAS YPPFESIDAN NQIVGFDVDL AQALCKEIDA        60
     TCTFSNQAFD SLIPSLKFRR VEAVMAGMDI TPEREKQVLF TTPYYDNSAL FVGQQGKYTS       120
     VDQLKGKKVG VQNGTTHQKF IMDKHPEITT VPYDSYQNAK LDLQNGRIDG VFGDTAVVTE       180
     WLKDNPKLAA VGDKVTDKDY FGTGLGIAVR QGNTELQQKL NTALEKVKKD GTYETIYNKW       240
     FQK                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page