(data stored in ACNUC7421 zone)

EMBL: AM946981.ARTM

AM946981.ARTM        Location/Qualifiers
FT   CDS             complement(905564..906232)
FT                   /transl_table=11
FT                   /gene="artM"
FT                   /locus_tag="B21_00872"
FT                   /product="artM, subunit of arginine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00872"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31389"
FT                   /protein_id="CAQ31389.1"
FT                   /translation="MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLV
FT                   WLVRGYITLFTGTPLLVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAA
FT                   YTTQLFYGAIRAIPEGQWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTS
FT                   LAYTITLMEVMGYSQLLYGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN
FT                   "
     MFEYLPELMK GLHTSLTLTV ASLIVALILA LIFTIILTLK TPVLVWLVRG YITLFTGTPL        60
     LVQIFLIYYG PGQFPTLQEY PALWHLLSEP WLCALIALSL NSAAYTTQLF YGAIRAIPEG       120
     QWQSCSALGM SKKDTLAILL PYAFKRSLSS YSNEVVLVFK STSLAYTITL MEVMGYSQLL       180
     YGRTYDVMVF GAAGIIYLVV NGLLTLMMRL IERKALAFER RN                          222
//

If you have problems or comments...

PBIL Back to PBIL home page