(data stored in ACNUC7421 zone)

EMBL: AM946981.ARTP

AM946981.ARTP        Location/Qualifiers
FT   CDS             complement(907704..908432)
FT                   /transl_table=11
FT                   /gene="artP"
FT                   /locus_tag="B21_00875"
FT                   /product="ArtP, subunit of arginine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00875"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31392"
FT                   /protein_id="CAQ31392.2"
FT                   /translation="MSIQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLL
FT                   RVLNLLEMPRSGTLNIAGNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLI
FT                   EAPCRVLGLSKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVL
FT                   LFDEPTAALDPEITAQIVSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQ
FT                   GDASCFTEPQTEAFKNYLSH"
     MSIQLNGINC FYGAHQALFD ITLDCPQGET LVLLGPSGAG KSSLLRVLNL LEMPRSGTLN        60
     IAGNHFDFTK TPSDKAIRDL RRNVGMVFQQ YNLWPHLTVQ QNLIEAPCRV LGLSKDQALA       120
     RAEKLLERLR LKPYSDRYPL HLSGGQQQRV AIARALMMEP QVLLFDEPTA ALDPEITAQI       180
     VSIIRELAET NITQVIVTHE VEVARKTASR VVYMENGHIV EQGDASCFTE PQTEAFKNYL       240
     SH                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page