(data stored in ACNUC7421 zone)

EMBL: AM946981.ARTQ

AM946981.ARTQ        Location/Qualifiers
FT   CDS             complement(906232..906948)
FT                   /transl_table=11
FT                   /gene="artQ"
FT                   /locus_tag="B21_00873"
FT                   /product="artQ, subunit of arginine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00873"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31390"
FT                   /protein_id="CAQ31390.1"
FT                   /translation="MNEFFPLASAAGMTVGLAVCALIVGLALAMFFAVWESAKWRPVAW
FT                   AGSALVTILRGLPEILVVLFIYFGSSQLLLTLSDGFTINLGFVQIPVQMDIENFDVSPF
FT                   LCGVIALSLLYAAYASQTLRGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALP
FT                   GLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQYI
FT                   LKRIDLRATRFERRPS"
     MNEFFPLASA AGMTVGLAVC ALIVGLALAM FFAVWESAKW RPVAWAGSAL VTILRGLPEI        60
     LVVLFIYFGS SQLLLTLSDG FTINLGFVQI PVQMDIENFD VSPFLCGVIA LSLLYAAYAS       120
     QTLRGALKAV PVGQWESGQA LGLSKSAIFF RLVMPQMWRH ALPGLGNQWL VLLKDTALVS       180
     LISVNDLMLQ TKSIATRTQE PFTWYIVAAA IYLVITLLSQ YILKRIDLRA TRFERRPS         238
//

If you have problems or comments...

PBIL Back to PBIL home page