(data stored in ACNUC7421 zone)

EMBL: AM946981.ATL

AM946981.ATL         Location/Qualifiers
FT   CDS             complement(445022..445411)
FT                   /transl_table=11
FT                   /gene="atl"
FT                   /locus_tag="B21_00410"
FT                   /product="DNA base-flipping protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30927"
FT                   /protein_id="CAQ30927.1"
FT                   /translation="MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIP
FT                   EGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQR
FT                   QALLAEGVMVSGSGQIDLQRYRWNY"
     MLVSCAMRLH SGVFPDYAEK LPQEEKMEKE DSFPQRVWQI VAAIPEGYVT TYGDVAKLAG        60
     SPRAARQVGG VLKRLPEGST LPWHRVVNRH GTISLTGPDL QRQRQALLAE GVMVSGSGQI       120
     DLQRYRWNY                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page