(data stored in ACNUC7421 zone)

EMBL: AM946981.COAE

AM946981.COAE        Location/Qualifiers
FT   CDS             complement(115404..116024)
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="B21_00102"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30619"
FT                   /protein_id="CAQ30619.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
     MRYIVALTGG IGSGKSTVAN AFADLGINVI DADIIARQVV EPGAPALHAI ADHFGANMIA        60
     ADGTLQRRAL RERIFANPEE KNWLNALLHP LIQQETQHQI QQATSPYVLW VVPLLVENSL       120
     YKKANRVLVV DVSPETQLKR TMQRDDVTRE HVEQILAAQA TREARLAVAD DVIDNNGAPD       180
     AIASDVARLH AHYLQLASQF VSQEKP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page