(data stored in ACNUC7421 zone)

EMBL: AM946981.CRCB

AM946981.CRCB        Location/Qualifiers
FT   CDS             complement(617910..618293)
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="B21_00583"
FT                   /product="protein involved in resistance to camphor-induced
FT                   chromosome decondensation"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31100"
FT                   /protein_id="CAQ31100.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLAA NLIGAFIIGM GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page