(data stored in ACNUC7421 zone)

EMBL: AM946981.CUSF

AM946981.CUSF        Location/Qualifiers
FT   CDS             555807..556139
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="B21_00523"
FT                   /product="periplasmic copper/silver-binding protein,
FT                   subunit of copper/silver transporting efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00523"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31040"
FT                   /protein_id="CAQ31040.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGEVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     MKKALQVAMF SLFTVIGFNA QANEHHHETM SEAQPQVISA TGEVKGIDLE SKKITIHHDP        60
     IAAVNWPEMT MRFTITPQTK MSEIKTGDKV AFNFVQQGNL SLLQDIKVSQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page