(data stored in ACNUC7421 zone)

EMBL: AM946981.CYNS

AM946981.CYNS        Location/Qualifiers
FT   CDS             329018..329488
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="B21_00298"
FT                   /product="cyanase monomer, subunit of cyanase dimer and
FT                   cyanase"
FT                   /EC_number="4.2.1.104"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00298"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30815"
FT                   /protein_id="CAQ30815.1"
FT                   /translation="MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTA
FT                   ALLGQQALPADAARLVGAKLDLDEDSILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF"
     MIQSQINRNI RLDLADAILL SKAKKDLSFA EIADGTGLAE AFVTAALLGQ QALPADAARL        60
     VGAKLDLDED SILLLQMIPL RGCIDDRIPT DPTMYRFYEM LQVYGTTLKA LVHEKFGDGI       120
     ISAINFKLDV KKVADPEGGE RAVITLDGKY LPTKPF                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page