(data stored in ACNUC7421 zone)

EMBL: AM946981.CYNT

AM946981.CYNT        Location/Qualifiers
FT   CDS             328328..328987
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="B21_00297"
FT                   /product="carbonic anhydrase monomer, subunit of carbonic
FT                   anhydrase 1"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00297"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30814"
FT                   /protein_id="CAQ30814.1"
FT                   /translation="MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAM
FT                   TAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTH
FT                   PSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA"
     MKEIIDGFLK FQREAFPKRE ALFKQLATQQ SPRTLFISCS DSRLVPELVT QREPGDLFVI        60
     RNAGNIVPSY GPEPGGVSAS VEYAVAALRV SDIVICGHSN CGAMTAIASC QCMDHMPAVS       120
     HWLRYADSAR VVNEARPHSD LPSKAAAMVR ENVIAQLANL QTHPSVRLAL EEGRIALHGW       180
     VYDIESGSIA AFDGATRQFV PLAANPRVCA IPLRQPTAA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page