(data stored in ACNUC7421 zone)

EMBL: AM946981.CYOD

AM946981.CYOD        Location/Qualifiers
FT   CDS             complement(415393..415722)
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="B21_00384"
FT                   /product="cytochrome bo terminal oxidase subunit IV,
FT                   subunit of cytochrome bo terminal oxidase"
FT                   /EC_number="1.10.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00384"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30901"
FT                   /protein_id="CAQ30901.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
     MSHSTDHSGA SHGSVKTYMT GFILSIILTV IPFWMVMTGA ASPAVILGTI LAMAVVQVLV        60
     HLVCFLHMNT KSDEGWNMTA FVFTVLIIAI LVVGSIWIMW NLNYNMMMH                   109
//

If you have problems or comments...

PBIL Back to PBIL home page