(data stored in ACNUC7421 zone)

EMBL: AM946981.DINJ

AM946981.DINJ        Location/Qualifiers
FT   CDS             complement(250810..251070)
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="B21_00225"
FT                   /product="antitoxin of YafQ-DinJ toxin-antitoxin system,
FT                   subunit of DinJ-YafQ complex"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00225"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30742"
FT                   /protein_id="CAQ30742.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGI"
     MAANAFVRAR IDEDLKNQAA DVLAGMGLTI SDLVRITLTK VAREKALPFD LREPNQLTIQ        60
     SIKNSEAGVD VHKAKDADDL FDKLGI                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page