(data stored in ACNUC7421 zone)

EMBL: AM946981.ERPA

AM946981.ERPA        Location/Qualifiers
FT   CDS             179447..179791
FT                   /transl_table=11
FT                   /gene="erpA"
FT                   /locus_tag="B21_00154"
FT                   /product="essential respiratory protein A"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00154"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30671"
FT                   /protein_id="CAQ30671.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
     MSDDVALPLE FTDAAANKVK SLIADEDNPN LKLRVYITGG GCSGFQYGFT FDDQVNEGDM        60
     TIEKQGVGLV VDPMSLQYLV GGSVDYTEGL EGSRFIVTNP NAKSTCGCGS SFSI             114
//

If you have problems or comments...

PBIL Back to PBIL home page