(data stored in ACNUC7421 zone)

EMBL: AM946981.FEPG

AM946981.FEPG        Location/Qualifiers
FT   CDS             complement(580677..581669)
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="B21_00545"
FT                   /product="fepG, subunit of ferric enterobactin ABC
FT                   transporter and Ferric Enterobactin Transport System"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00545"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31062"
FT                   /protein_id="CAQ31062.1"
FT                   /translation="MIYVSRRLLITCLLLISACVVAGIWGLRSGAVTLETSQVFAALRG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALSAMVGGIVTSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAATLLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     MIYVSRRLLI TCLLLISACV VAGIWGLRSG AVTLETSQVF AALRGDAPRS MTMVVTEWRL        60
     PRVLMALLIG AALGVSGAIF QSLMRNPLGS PDVMGFNTGA WSGVLVAMVL FGQDLTAIAL       120
     SAMVGGIVTS LLVWLLAWRN GIDTFRLIII GIGVRAMLVA FNTWLLLKAS LETALTAGLW       180
     NAGSLNGLTW AKTSPSAPII ILMLIAATLL VRRMRLLEMG DDTACALGVS VERSRLLMML       240
     VAVVLTAAAT ALAGPISFIA LVAPHIARRI SGTARWGLTQ AALCGALLLL AADLCAQQLF       300
     MPYQLPVGVV TVSLGGIYLI VLLIQESRKK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page