(data stored in SCRATCH zone)

EMBL: AM946981.FSAA

AM946981.FSAA        Location/Qualifiers
FT   CDS             847555..848217
FT                   /transl_table=11
FT                   /gene="fsaA"
FT                   /locus_tag="B21_00809"
FT                   /product="Fsa, subunit of fructose 6-phosphate aldolase 1"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00809"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31326"
FT                   /protein_id="CAQ31326.1"
FT                   /translation="MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPE
FT                   LHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGI
FT                   TTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVL
FT                   AASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWLGAFGRTSI"
     MELYLDTSDV VAVKALSRIF PLAGVTTNPS IIAAGKKPLD VVLPELHEAM GGQGRLFAQV        60
     MATTAEGMVN DALKLRSIIA DIVVKVPVTA EGLAAIKMLK AEGITTLGTA VYGAAQGLLS       120
     ALAGAEYVAP YVNRIDAQGG SGIQTVTDLH QLLKMHAPQA KVLAASFKTP RQALDCLLAG       180
     CESITLPLDV AQQMISYPAV DAAVAKFEQD WLGAFGRTSI                             220
//

If you have problems or comments...

PBIL Back to PBIL home page