(data stored in ACNUC7421 zone)

EMBL: AM946981.FTSL

AM946981.FTSL        Location/Qualifiers
FT   CDS             93837..94202
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="B21_00083"
FT                   /product="essential cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30600"
FT                   /protein_id="CAQ30600.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page