(data stored in SCRATCH zone)

EMBL: AM946981.GAM

AM946981.GAM         Location/Qualifiers
FT   CDS             complement(757931..758347)
FT                   /transl_table=11
FT                   /gene="gam"
FT                   /locus_tag="B21_00714"
FT                   /product="enterobacteria phage lambda, host-nuclease
FT                   inhibitor protein Gam"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00714"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31231"
FT                   /protein_id="CAQ31231.1"
FT                   /translation="MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYY
FT                   IQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITR
FT                   AFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV"
     MDINTETEIK QKHSLTPFPV FLISPAFRGR YFHSYFRSSA MNAYYIQDRL EAQSWARHYQ        60
     QLAREEKEAE LADDMEKGLP QHLFESLCID HLQRHGASKK SITRAFDDDV EFQERMAEHI       120
     RYMVETIAHH QVDIDSEV                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page