(data stored in ACNUC7421 zone)

EMBL: AM946981.GLNH

AM946981.GLNH        Location/Qualifiers
FT   CDS             complement(831244..831990)
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="B21_00795"
FT                   /product="glnH, subunit of glutamine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00795"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31312"
FT                   /protein_id="CAQ31312.1"
FT                   /translation="MKSVLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDK
FT                   YVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFS
FT                   DGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDN
FT                   AYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKV
FT                   NGALKTLRENGTYNEIYKKWFGTEPK"
     MKSVLKVSLA ALTLAFAVSS HAADKKLVVA TDTAFVPFEF KQGDKYVGFD VDLWAAIAKE        60
     LKLDYELKPM DFSGIIPALQ TKNVDLALAG ITITDERKKA IDFSDGYYKS GLLVMVKANN       120
     NDVKSVKDLD GKVVAVKSGT GSVDYAKANI KTKDLRQFPN IDNAYMELGT NRADAVLHDT       180
     PNILYFIKTA GNGQFKAVGD SLEAQQYGIA FPKGSDELRD KVNGALKTLR ENGTYNEIYK       240
     KWFGTEPK                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page