(data stored in ACNUC7421 zone)

EMBL: AM946981.GLTK

AM946981.GLTK        Location/Qualifiers
FT   CDS             complement(644260..644934)
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="B21_00611"
FT                   /product="gltK, subunit of GltIJKL glutamate ABC
FT                   transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31128"
FT                   /protein_id="CAQ31128.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
     MYEFDWSSIV PSLPYLLDGL VITLKITVTA VVIGILWGTM LAVMRLSSFA PVAWFAKAYV        60
     NVFRSIPLVM VLLWFYLIVP GFLQNVLGLS PKNDIRLISA MVAFSMFEAA YYSEIIRAGI       120
     QSISRGQSSA ALALGMTHWQ SMKLIILPQA FRAMVPLLLT QGIVLFQDTS LVYVLSLADF       180
     FRTASTIGER DGTQVEMILF AGFVYFVISL SASLLVSYLK RRTA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page