(data stored in SCRATCH zone)

EMBL: AM946981.GSIA

AM946981.GSIA        Location/Qualifiers
FT   CDS             851466..853304
FT                   /transl_table=11
FT                   /gene="gsiA"
FT                   /locus_tag="B21_00813"
FT                   /product="GsiA, subunit of gsiABCD glutathione ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00813"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31330"
FT                   /protein_id="CAQ31330.1"
FT                   /translation="MLAVENLNIAFMQDQQKIAAVRNLSFSLQRGETLAIVGESGSGKS
FT                   VTALALMRLLEQAGGLVQCDKMLLQRRSREVIELSEQNAAQMRHVRGADMAMIFQEPMT
FT                   SLNPVFTVGEQIAESIRLHQNASREEAMVEAKRMLDQVRIPEAQTILSRYPHQLSGGMR
FT                   QRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQKEMSMGVIFITHDMGVVA
FT                   EIADRVLVMYQGEAVETGTVEQIFHAPQHPYTRALLAAVPQLGAMKGLDYPRRFPLISL
FT                   EHPAKQAPPIEQKTVVDGEPVLRVRNLVTRFPLRSGLLNRVTREVHAVEKVSFDLWPGE
FT                   TLSLVGESGSGKSTTGRALLRLVESQGGEIIFNGQRIDTLSPGKLQALRRDIQFIFQDP
FT                   YASLDPRQTIGDSIIEPLRVHGLLPGKDAAARVAWLLERVGLLPEHAWRYPHEFSGGQR
FT                   QRICIARALALNPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVE
FT                   RISHRVAVMYLGQIVEIGPRRAVFENPQHPYTRKLLAAVPVAEPSRQRPQRVLLSDDLP
FT                   SNIHLRGEEVAAVSLQCVGPGHYVAQPQSEYAFMRR"
     MLAVENLNIA FMQDQQKIAA VRNLSFSLQR GETLAIVGES GSGKSVTALA LMRLLEQAGG        60
     LVQCDKMLLQ RRSREVIELS EQNAAQMRHV RGADMAMIFQ EPMTSLNPVF TVGEQIAESI       120
     RLHQNASREE AMVEAKRMLD QVRIPEAQTI LSRYPHQLSG GMRQRVMIAM ALSCRPAVLI       180
     ADEPTTALDV TIQAQILQLI KVLQKEMSMG VIFITHDMGV VAEIADRVLV MYQGEAVETG       240
     TVEQIFHAPQ HPYTRALLAA VPQLGAMKGL DYPRRFPLIS LEHPAKQAPP IEQKTVVDGE       300
     PVLRVRNLVT RFPLRSGLLN RVTREVHAVE KVSFDLWPGE TLSLVGESGS GKSTTGRALL       360
     RLVESQGGEI IFNGQRIDTL SPGKLQALRR DIQFIFQDPY ASLDPRQTIG DSIIEPLRVH       420
     GLLPGKDAAA RVAWLLERVG LLPEHAWRYP HEFSGGQRQR ICIARALALN PKVIIADEAV       480
     SALDVSIRGQ IINLLLDLQR DFGIAYLFIS HDMAVVERIS HRVAVMYLGQ IVEIGPRRAV       540
     FENPQHPYTR KLLAAVPVAE PSRQRPQRVL LSDDLPSNIH LRGEEVAAVS LQCVGPGHYV       600
     AQPQSEYAFM RR                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page