(data stored in ACNUC7421 zone)

EMBL: AM946981.HHA

AM946981.HHA         Location/Qualifiers
FT   CDS             complement(449130..449348)
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="B21_00416"
FT                   /product="haemolysin expression modulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00416"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30933"
FT                   /protein_id="CAQ30933.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
     MSEKPLTKTD YLMRLRRCQT IDTLERVIEK NKYELSDNEL AVFYSAADHR LAELTMNKLY        60
     DKIPSSVWKF IR                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page