(data stored in ACNUC7421 zone)

EMBL: AM946981.HLPA

AM946981.HLPA        Location/Qualifiers
FT   CDS             203319..203804
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="B21_00175"
FT                   /product="periplasmic chaperone, subunit of Skp periplasmic
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30692"
FT                   /protein_id="CAQ30692.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
     MKKWLLAAGL GLALATSAQA ADKIAIVNMG SLFQQVAQKT GVSNTLENEF KGRASELQRM        60
     ETDLQAKMKK LQSMKAGSDR TKLEKDVMAQ RQTFAQKAQA FEQDRARRSN EERGKLVTRI       120
     QTAVKSVANS QDIDLVVDAN AVAYNSSDVK DITADVLKQV K                           161
//

If you have problems or comments...

PBIL Back to PBIL home page