(data stored in SCRATCH zone)

EMBL: AM946981.HOKC

AM946981.HOKC        Location/Qualifiers
FT   CDS             complement(16749..16901)
FT                   /transl_table=11
FT                   /gene="hokC"
FT                   /locus_tag="B21_00017"
FT                   /product="HokC, Gef toxin; interferes with membrane
FT                   function when in excess, subunit of Gef dimer"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00017"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30534"
FT                   /protein_id="CAQ30534.1"
FT                   /translation="MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFT
FT                   AYESE"
     MKQHKAMIVA LIVICITAVV AALVTRKDLC EVHIRTGQTE VAVFTAYESE                   50
//

If you have problems or comments...

PBIL Back to PBIL home page