(data stored in ACNUC7421 zone)

EMBL: AM946981.HPT

AM946981.HPT         Location/Qualifiers
FT   CDS             144235..144771
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="B21_00123"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase,
FT                   subunit of hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00123"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30640"
FT                   /protein_id="CAQ30640.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGS
FT                   FMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYIGKVILLDE"
     MKHTVEVMIP EAEIKARIAE LGRQITERYK DSGSDMVLVG LLRGSFMFMA DLCREVQVSH        60
     EVDFMTASSY GSGMSTTRDV KILKDLDEDI RGKDVLIVED IIDSGNTLSK VREILSLREP       120
     KSLAICTLLD KPSRREVNVP VEFIGFSIPD EFVVGYGIDY AQRYRHLPYI GKVILLDE         178
//

If you have problems or comments...

PBIL Back to PBIL home page