(data stored in ACNUC7421 zone)

EMBL: AM946981.HUPB

AM946981.HUPB        Location/Qualifiers
FT   CDS             430479..430751
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="B21_00396"
FT                   /product="transcriptional dual regulator HU-beta, NS1
FT                   (HU-1), subunit of HU transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00396"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30913"
FT                   /protein_id="CAQ30913.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     MNKSQLIDKI AAGADISKAA AGRALDAIIA SVTESLKEGD DVALVGFGTF AVKERAARTG        60
     RNPQTGKEIT IAAAKVPSFR AGKALKDAVN                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page