(data stored in ACNUC7421 zone)

EMBL: AM946981.INSA-12

AM946981.INSA-12     Location/Qualifiers
FT   CDS             complement(612188..612463)
FT                   /transl_table=11
FT                   /gene="insA-12"
FT                   /locus_tag="B21_00577"
FT                   /product="IS1 protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00577"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31094"
FT                   /protein_id="CAQ31094.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR"
     MASVSISCPS CSATDGVVRN GKSTAGHQRY LCSHCRKTWQ LQFTYTASQP GTHQKIIDMA        60
     MNGVGCRATA RIMGVGLNTI LRHLKNSGRS R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page