(data stored in SCRATCH zone)

EMBL: AM946981.INSB-13

AM946981.INSB-13     Location/Qualifiers
FT   CDS             241503..242006
FT                   /transl_table=11
FT                   /gene="insB-13"
FT                   /locus_tag="B21_00216"
FT                   /product="IS1 protein InsB"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00216"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30733"
FT                   /protein_id="CAQ30733.1"
FT                   /translation="MPGNCPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
     MPGNCPHYGR WPQHDFTSLK KLRPQSVTSR IQPGSDVIVC AEMDEQWGYV GAKSRQRWLF        60
     YAYDSLRKTV VAHVFGERTM ATLGRLMSLL SPFDVVIWMT DGWPLYESRL KGKLHVISKR       120
     YTQRIERHNL NLRQHLARLG RKSLSFSKSV ELHDKVIGHY LNIKHYQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page