(data stored in SCRATCH zone)

EMBL: AM946981.INSJ-1

AM946981.INSJ-1      Location/Qualifiers
FT   CDS             566315..566836
FT                   /transl_table=11
FT                   /gene="insJ-1"
FT                   /locus_tag="B21_00532"
FT                   /product="IS150 protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00532"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31049"
FT                   /protein_id="CAQ31049.1"
FT                   /translation="MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVAL
FT                   YEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVY
FT                   EERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKK
FT                   LKALAHPTKK"
     MSKPKYPFEK RLEVVNHYFT TDDGYRIISA RFGVPRTQVR TWVALYEKHG EKGLIPKPKG        60
     VSADPELRIK VVKAVIEQHM SLNQAAAHFM LAGSGSVARW LKVYEERGEA GLRALKIGTK       120
     RNIAISVDPE KAASALELSK DRRIEDLERQ VRFLETRLMY LKKLKALAHP TKK              173
//

If you have problems or comments...

PBIL Back to PBIL home page