(data stored in ACNUC7421 zone)

EMBL: AM946981.INSJ-2

AM946981.INSJ-2      Location/Qualifiers
FT   CDS             642508..643029
FT                   /transl_table=11
FT                   /gene="insJ-2"
FT                   /locus_tag="B21_00608"
FT                   /product="IS150 protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00608"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31125"
FT                   /protein_id="CAQ31125.1"
FT                   /translation="MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVAL
FT                   YEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVY
FT                   EERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKK
FT                   LKALAHPTKK"
     MSKPKYPFEK RLEVVNHYFT TDDGYRIISA RFGVPRTQVR TWVALYEKHG EKGLIPKPKG        60
     VSADPELRIK VVKAVIEQHM SLNQAAAHFM LAGSGSVARW LKVYEERGEA GLRALKIGTK       120
     RNIAISVDPE KAASALELSK DRRIEDLERQ VRFLETRLMY LKKLKALAHP TKK              173
//

If you have problems or comments...

PBIL Back to PBIL home page