(data stored in SCRATCH zone)

EMBL: AM946981.INSK-2

AM946981.INSK-2      Location/Qualifiers
FT   CDS             join(642982..642996,642996..643877)
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="insK-2"
FT                   /locus_tag="B21_00609"
FT                   /product="IS150 conserved protein InsB"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00609"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31126"
FT                   /protein_id="CAQ31126.2"
FT                   /translation="MYLKKAESLSSSHEKVKVLNELRQFYPLDELLRAAEIPRSTFYYH
FT                   LKALSKPDKYADVKKRISEIYHENRGRYGYRRVTLSLHREGKQINHKAVQRLMGTLSLK
FT                   AAIKVKRYRSYRGEVGQTAPNVLQRDFKATRPNEKWVTDVTEFAVNGRKLYLSPVIDLF
FT                   NNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGI
FT                   KQSMSRKGNCLDNAVVECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKL
FT                   KGLTPIEYRNQTYMPRV"
     MYLKKAESLS SSHEKVKVLN ELRQFYPLDE LLRAAEIPRS TFYYHLKALS KPDKYADVKK        60
     RISEIYHENR GRYGYRRVTL SLHREGKQIN HKAVQRLMGT LSLKAAIKVK RYRSYRGEVG       120
     QTAPNVLQRD FKATRPNEKW VTDVTEFAVN GRKLYLSPVI DLFNNEVISY SLSERPVMNM       180
     VENMLDQAFK KLNPHEHPVL HSDQGWQYRM RRYQNILKEH GIKQSMSRKG NCLDNAVVEC       240
     FFGTLKSECF YLDEFSNISE LKDAVTEYIE YYNSRRISLK LKGLTPIEYR NQTYMPRV         298
//

If you have problems or comments...

PBIL Back to PBIL home page